PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0012s0660.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1724aa    MW: 194973 Da    PI: 6.14
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0012s0660.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-192782257
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             kR+  t+ qle+Le++++ + yps+e+r+eL++klgL++rq ++WF+ rR k+kk
  SapurV1A.0012s0660.4.p 27 PKRQMKTPFQLETLEKAYAAETYPSEEMRAELSEKLGLSDRQLQMWFCHRRLKDKK 82
                            69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-19883IPR009057Homeodomain-like
SuperFamilySSF466893.42E-171583IPR009057Homeodomain-like
PROSITE profilePS5007117.22383IPR001356Homeobox domain
SMARTSM003895.2E-192587IPR001356Homeobox domain
PfamPF000464.1E-172782IPR001356Homeobox domain
CDDcd000862.71E-142883No hitNo description
SMARTSM005714.3E-22514573IPR018501DDT domain
PROSITE profilePS5082716.662514573IPR018501DDT domain
PfamPF027916.7E-18515570IPR018501DDT domain
PfamPF050664.5E-16696764IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.9E-7903946IPR028942WHIM1 domain
PfamPF156131.8E-1310851157IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1724 aa     Download sequence    Send to blast
MEANSDEEDH NRSKSNVMSS NEGQSKPKRQ MKTPFQLETL EKAYAAETYP SEEMRAELSE  60
KLGLSDRQLQ MWFCHRRLKD KKETPVKKQR NAAPLPESPL EEMRVAGAEN GSDYGSGSGS  120
GSSPLSESRK VVLDDGHMMR RYYDSSPQSV MELRAIACVE AQLGEPLRED GPILGMDFDH  180
LPPDAFGTPI ASISEQQKRM GYSYEDKIYE RHDAKSSKDH ASIRSDAYGL AQSPYHDSPA  240
DTLRGRASPF GAGQMPRARL LSQQDKRGHI FSSPQRDDDF IPQRDTFANN RTSAQSITHP  300
IMGPENPNVF SDAQTFHHDT ELRLERKRKI EEPRTIRDVE AYESRMRKEL EKQDILRRKN  360
EERMRKEMER HDRERRKEEE RLMRERQREE ERTLREQKRE HERREKFMQK EYLRAEKRRQ  420
KEELRREKEA VKRKAAMEKA TARKIAKDSL DLIEDEQLEL MELAAASKGL ASIVNLNYDT  480
LQNLDSFRDL LITFPSKSVQ LKKPFGFQPW LDSEENIGNL LMVWRFFITF ADVLGLWPFT  540
LDEFVQAFHD YDSRLLSELH IALLKLIIKD IEDVARTPSS GLGINQYYTA NPEGGHPQIV  600
RGAYTWGFDI RNWQQHLNPL TWPEILRQLA LSAGFGPQLR KRNATWTGLG DIDEVKDCED  660
IISTIRNGSA AENAFALMRE KGLLLPRRSR HRLTPGTVKF AAFHVLSLEG SKGLTVLELA  720
DKIQKSGLRD LTTSKTPEAS ISVALTRDQK LFERIAPSTY CLRAAFRKDP ADAEAILAAA  780
RKKIRIFENG FLGGEVVDDV ERDEDSEGDE DPEVDDLTTP LSANKSFVHS SKLNTLPVSG  840
KYKVGNDVSL TVQNESEKGL STFSLNGPKD VMAPIIIEQC VTHKDEGTNN GNGRDIEIDE  900
TKSGESWIQG LTEGEYSHLT VEERLNALVV LVGIANEGNS IRAVLEDRLE AANALKKQMW  960
AEAQLDRSRL KEEFVSKLDF PSLTVGRVET QFASSAVEGS QSPLVLADSK NKEASPSNAE  1020
DRKPLAENVE NHLSIVLSEK ALVVQDLSMN PDNISMQQHG YASKRSRSQL KAYVTHLAEE  1080
MYIYRSLPLG QDRRRNRYWQ FVASASRNDP CSGRIFVELH DSNWRVIDSE EAFDTLLSSL  1140
DTRGVRESHL RIMLQKIESS FKENLQRNLW SPSIVCQSGT TDDKKAEKDN GNCAASIDGP  1200
SSMLRVSSSD SFDTFSSFRI ELGRTSAEKK GALKRYQDFQ NWMWKDCFNS STLCSMKYGK  1260
KRCEQLLDTC NLCFSSYLSE DTHCLSCHQA FKVDNKNFDF AEHEIQCKEK SFDPGNARAC  1320
DSCLPLGVRL LTALLGSIEV SVPQEALESF WMEIRRKDWG VKLIKSSSTE ELLQRLTVFE  1380
SAIKRQRLSS NFETTKELLG SSVSSGSAAH DSASLGSVSL LPWIPKTSAA MALRLFELDA  1440
SIIYVKNEKP EPSTDKSVKV YMKLPSRYSD FKNEVEIKDV KLEEHNKEIV DLRGKRSNYK  1500
RGRGGRDQGL ATKWQRRVPG LKSDTRRQSS SRGVQNLNQG SRQQGRKTNL QASSRGRRTV  1560
RKRRVEKMVA KEPLPGRMTN KVAAPMSYLS KKTAVHNSYV KSFRNLDDED WSAKRGRMNA  1620
VGDDNSNSME EAESDDNVEE EVSGQGNWEP RFNGTPNGWN GNSMEVSDDD GDASNGDASN  1680
GVAAMGDDDS EGDVEMSDRS DREANQVQND EGLDFADSDE YSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17582RRLKDKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027775.10.0PREDICTED: uncharacterized protein LOC105127984 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLB9H2Q70.0B9H2Q7_POPTR; Uncharacterized protein
STRINGPOPTR_0004s04840.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1